PPIRE16434
Target Protein Information
| Protein_Name | Streptavidin |
|---|---|
| Protein_Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Organism_Source | Streptomyces avidinii |
| Functional_Classification | biotin-binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P22629 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | D1.3 Fv-Strep-tag |
|---|---|
| Peptide_Sequence | AWRHPQFGG |
| Peptide_Length | 9 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1055.16 |
|---|---|
| Aliphatic_Index | 11.11111 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 3.22222 |
| Charge_at_pH_7 | 1.08889 |
| Isoelectric_Point | 10.55176 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 436.79000 |
| X_logP_energy | -3.47313 |
Interaction Information
| Affinity | KD=18.52 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Molecular Interaction Between the Strep-tag Affinity Peptide and its Cognate Target Streptavidin |
| Release_Year | 1996 |
| PMID | 8636976 |
| DOI | 10.1006/jmbi.1996.0061 |