PPIRE16496
Target Protein Information
| Protein_Name | Mitogen-activated protein kinase 14 |
|---|---|
| Protein_Sequence | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
| Organism_Source | Homo sapiens |
| Functional_Classification | mitogen activated protein kinases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAPK14 |
| UniProt_ID | Q16539 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | VWCS |
|---|---|
| Peptide_Sequence | VWCS |
| Peptide_Length | 4 |
| Peptide_SMILES | CC(C)[C@H](N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 493.58 |
|---|---|
| Aliphatic_Index | 72.50000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -0.06399 |
| Isoelectric_Point | 5.92254 |
|---|---|
| Hydrogen_Bond_Acceptors | 7 |
| Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 186.64000 |
| X_logP_energy | -0.84520 |
Interaction Information
| Affinity | KD=7.22 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development of peptide inhibitor as a therapeutic agent against head and neck squamous cell carcinoma (HNSCC) targeting p38u MAP kinase |
| Release_Year | 2013 |
| PMID | 23238519 |
| DOI | 10.1016/j.bbagen.2012.12.001 |