PPIRE16511
Target Protein Information
| Protein_Name | Ig gamma-2A chain C region A allele |
|---|---|
| Protein_Sequence | AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | IgG |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg |
| UniProt_ID | P01863 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FcBP5 |
|---|---|
| Peptide_Sequence | CFEDFNEQRTC |
| Peptide_Length | 11 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C1<-->C11; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1391.49 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 4.09091 |
| Charge_at_pH_7 | -2.12197 |
| Isoelectric_Point | 3.92753 |
|---|---|
| Hydrogen_Bond_Acceptors | 21 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 634.53000 |
| X_logP_energy | -7.41943 |
Interaction Information
| Affinity | KD=4.02 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Efficient selection of IgG Fc domain-binding peptides fused to fluorescent protein using E. coli expression system and dot-blotting assay |
| Release_Year | 2010 |
| PMID | 20025916 |
| DOI | 10.1016/j.peptides.2009.12.009 |