PPIRE16519
Target Protein Information
| Protein_Name | Envelope glycoprotein D |
|---|---|
| Protein_Sequence | MGGAAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMRRRTQKAPKRIRLPHIREDDQPSSHQPLFY |
| Organism_Source | Human herpesvirus 1 (strain F) |
| Functional_Classification | viral glycoproteins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | gD |
| UniProt_ID | Q05059 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LKMADPNRFKGKDL |
|---|---|
| Peptide_Sequence | LKMADPNRFKGKDL |
| Peptide_Length | 14 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1632.94 |
|---|---|
| Aliphatic_Index | 62.85714 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 4.07143 |
| Charge_at_pH_7 | 1.99799 |
| Isoelectric_Point | 10.50060 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 690.48000 |
| X_logP_energy | -5.57873 |
Interaction Information
| Affinity | IC50=8 pM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis solution structure analysis and antibody binding of cyclic epitope peptides from glycoprotein D of Herpes simplex virus type I |
| Release_Year | 2003 |
| PMID | 14556904 |
| DOI | 10.1016/S0301-4622(03)00187-X |