PPIRE16524
Target Protein Information
| Protein_Name | Envelope glycoprotein D |
|---|---|
| Protein_Sequence | MGGAAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMRRRTQKAPKRIRLPHIREDDQPSSHQPLFY |
| Organism_Source | Human herpesvirus 1 (strain F) |
| Functional_Classification | viral glycoproteins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | gD |
| UniProt_ID | Q05059 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LKwHcyADPNRFKxGKDL |
|---|---|
| Peptide_Sequence | LKXHcyADPNRFKXGKDL |
| Peptide_Length | 18 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC(C)C)C(=O)O |
| Chemical_Modification | X3=homocysteine; X11=S-carboxymethyllysine |
| Cyclization_Method | Side chain-side chain cyclization; X3<-->K11; other bonds |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2019.31 |
|---|---|
| Aliphatic_Index | 48.88889 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.72222 |
| Charge_at_pH_7 | 2.02607 |
| Isoelectric_Point | 9.37019 |
|---|---|
| Hydrogen_Bond_Acceptors | 29 |
| Hydrogen_Bond_Donors | 30 |
| Topological_Polar_Surface_Area | 855.79000 |
| X_logP_energy | -8.28593 |
Interaction Information
| Affinity | EC50=4443 pM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis solution structure analysis and antibody binding of cyclic epitope peptides from glycoprotein D of Herpes simplex virus type I |
| Release_Year | 2003 |
| PMID | 14556904 |
| DOI | 10.1016/S0301-4622(03)00187-X |