PPIRE16562
Target Protein Information
| Protein_Name | F-box/WD repeat-containing protein 1A |
|---|---|
| Protein_Sequence | MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin ligases |
| Cellular_Localization | Nucleus |
| Gene_Names | BTRC |
| UniProt_ID | Q9Y297 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 32P-u-catenin |
|---|---|
| Peptide_Sequence | DRKAAVSHWQQQSYLDSGIHSGATTTAPSLSG |
| Peptide_Length | 32 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CC(=O)O)C(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)NCC(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | S17=phosphoserine; S21=phosphoserine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3357.60 |
|---|---|
| Aliphatic_Index | 58.12500 |
| Aromaticity | 0.06250 |
| Average_Rotatable_Bonds | 3.34375 |
| Charge_at_pH_7 | 0.17955 |
| Isoelectric_Point | 7.70504 |
|---|---|
| Hydrogen_Bond_Acceptors | 52 |
| Hydrogen_Bond_Donors | 54 |
| Topological_Polar_Surface_Area | 1523.87000 |
| X_logP_energy | -22.46033 |
Interaction Information
| Affinity | KD=1000 uM |
|---|---|
| Affinity_Assay | WaterLOGSY |
| PDB_ID | None |
| Type | Substrate |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Transfer-NMR and Docking Studies Identify the Binding of the Peptide Derived from Activating Transcription Factor 4 to Protein Ubiquitin Ligase u-TrCP |
| Release_Year | 2008 |
| PMID | 18052253 |
| DOI | 10.1021/bi7014212 |