PPIRE16624
Target Protein Information
| Protein_Name | Fatty acid-binding protein heart |
|---|---|
| Protein_Sequence | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
| Organism_Source | Homo sapiens |
| Functional_Classification | Lipid binding proteins fatty acid binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | FABP3 |
| UniProt_ID | P05413 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | A-CooP-K |
|---|---|
| Peptide_Sequence | ACGLSGLGVAK |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](C)N)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 975.17 |
|---|---|
| Aliphatic_Index | 115.45455 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.90909 |
| Charge_at_pH_7 | 0.93571 |
| Isoelectric_Point | 8.54519 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 400.57000 |
| X_logP_energy | -5.02040 |
Interaction Information
| Affinity | KD=0.07 uM |
|---|---|
| Affinity_Assay | Microscale Thermophoresis |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Tumor-Targeting Peptides: The Functional Screen of Glioblastoma Homing Peptides to the Target Protein FABP3 (MDGI) |
| Release_Year | 2020 |
| PMID | 32650473 |
| DOI | 10.3390/cancers12071836 |