PPIRE16625
Target Protein Information
| Protein_Name | Fatty acid-binding protein heart |
|---|---|
| Protein_Sequence | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA |
| Organism_Source | Homo sapiens |
| Functional_Classification | Lipid binding proteins fatty acid binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | FABP3 |
| UniProt_ID | P05413 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | A-[Ala7]CooP |
|---|---|
| Peptide_Sequence | ACGLSGLAVA |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](C)N)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)O)C(C)C |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 861.02 |
|---|---|
| Aliphatic_Index | 137.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.60000 |
| Charge_at_pH_7 | -0.06399 |
| Isoelectric_Point | 5.92254 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 345.45000 |
| X_logP_energy | -4.24570 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Tumor-Targeting Peptides: The Functional Screen of Glioblastoma Homing Peptides to the Target Protein FABP3 (MDGI) |
| Release_Year | 2020 |
| PMID | 32650473 |
| DOI | 10.3390/cancers12071836 |