PPIRE16743
Target Protein Information
| Protein_Name | Genome polyprotein |
|---|---|
| Protein_Sequence | RNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASAYQVRNSSGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVHEGNVSRCWVAMTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSI |
| Organism_Source | Hepatitis C virus (isolate EC1) |
| Functional_Classification | core protein |
| Cellular_Localization | Cytoplasm |
| Gene_Names | None |
| UniProt_ID | P27954 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HCV3 |
|---|---|
| Peptide_Sequence | LSADTLRSNSVDHDRVQNEVRSSREQPR |
| Peptide_Length | 28 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(C)C)[C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3252.47 |
|---|---|
| Aliphatic_Index | 62.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.96429 |
| Charge_at_pH_7 | 0.09377 |
| Isoelectric_Point | 7.55411 |
|---|---|
| Hydrogen_Bond_Acceptors | 50 |
| Hydrogen_Bond_Donors | 59 |
| Topological_Polar_Surface_Area | 1658.65000 |
| X_logP_energy | -24.86585 |
Interaction Information
| Affinity | KD=72 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Epitope mapping of anti-HIV and anti-HCV monoclonal antibodies and characterization of epitope mimics using a filamentous phage peptide library |
| Release_Year | 1995 |
| PMID | 8543161 |
| DOI | 10.1016/0378-1119(95)00658-3 |