PPIRE16767
Target Protein Information
| Protein_Name | Streptavidin |
|---|---|
| Protein_Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Organism_Source | Streptomyces avidinii |
| Functional_Classification | biotin-binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P22629 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FSHPQNT |
|---|---|
| Peptide_Sequence | FSHPQNT |
| Peptide_Length | 7 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 829.87 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.28571 |
| Charge_at_pH_7 | 0.08889 |
| Isoelectric_Point | 7.55032 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 384.45000 |
| X_logP_energy | -5.46420 |
Interaction Information
| Affinity | KD=100 uM |
|---|---|
| Affinity_Assay | binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Transferred NOESY NMR Studies of Biotin Mimetic Peptide (FSHPQNT) Bound to Streptavidin: A Structural Model for Studies of Peptiderotein Interactions |
| Release_Year | 2011 |
| PMID | 21294848 |
| DOI | 10.1111/j.1747-0285.2011.01096.x |