PPIRE16775
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 1/Immunoglobulin lambda constant 1 |
|---|---|
| Protein_Sequence | ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA/GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS |
| Organism_Source | Homo sapiens/Homo sapiens |
| Functional_Classification | immunoglobulin |
| Cellular_Localization | Extracellular |
| Gene_Names | IGHG1/IGLC1 |
| UniProt_ID | P01857/P0CG04 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Fluorescent_probe_(6-FAM)KI(pY)VV |
|---|---|
| Peptide_Sequence | KIYVV |
| Peptide_Length | 5 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@H](C(=O)O)C(C)C)C(C)C |
| Chemical_Modification | Y3=phosphotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | 6-FAM |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 620.79 |
|---|---|
| Aliphatic_Index | 194.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.80000 |
| Charge_at_pH_7 | 0.99684 |
| Isoelectric_Point | 9.29830 |
|---|---|
| Hydrogen_Bond_Acceptors | 8 |
| Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 225.97000 |
| X_logP_energy | 0.77290 |
Interaction Information
| Affinity | KD=41 nM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of peptidic substrates for the human kinase Myt1 using peptide microarrays |
| Release_Year | 2015 |
| PMID | 26059593 |
| DOI | 10.1016/j.bmc.2015.05.021 |