PPIRE16857
Target Protein Information
| Protein_Name | Src substrate cortactin |
|---|---|
| Protein_Sequence | MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPIYEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ |
| Organism_Source | Mus musculus |
| Functional_Classification | actin binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Cttn |
| UniProt_ID | Q60598 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | S1 |
|---|---|
| Peptide_Sequence | KPPVPPKPKXKP |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCCN)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | X10=norleucine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1269.60 |
|---|---|
| Aliphatic_Index | 24.16667 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.83333 |
| Charge_at_pH_7 | 3.99680 |
| Isoelectric_Point | 11.27833 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 434.76000 |
| X_logP_energy | -2.42830 |
Interaction Information
| Affinity | KD=0.5 uM |
|---|---|
| Affinity_Assay | circular dichroism |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Recognition of Lysine-Rich Peptide Ligands by Murine Cortactin SH3 Domain: CD ITC and NMR Studies |
| Release_Year | 2009 |
| PMID | 19921743 |
| DOI | 10.1002/bip.21350 |