PPIRE16892
Target Protein Information
| Protein_Name | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 |
|---|---|
| Protein_Sequence | MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK |
| Organism_Source | Homo sapiens |
| Functional_Classification | peptidyl prolyl cis trans isomerases |
| Cellular_Localization | Mitochondria |
| Gene_Names | PIN4 |
| UniProt_ID | Q9Y237 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | KHSPVHIGGGS-NH2 |
|---|---|
| Peptide_Sequence | KHSPVHIGGGS |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](N)CCCCN)C(C)C)C(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1075.19 |
|---|---|
| Aliphatic_Index | 61.81818 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | 1.17951 |
| Isoelectric_Point | 9.70398 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 469.37000 |
| X_logP_energy | -6.60600 |
Interaction Information
| Affinity | KD=0.7 mM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification and characterization of peptides that bind the PPIase domain of Parvulin17 |
| Release_Year | 2013 |
| PMID | 23596087 |
| DOI | 10.1002/psc.2510 |