PPIRE16895
Target Protein Information
| Protein_Name | Neurotensin/neuromedin N |
|---|---|
| Protein_Sequence | MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY |
| Organism_Source | Homo sapiens |
| Functional_Classification | Hormones neuropeptides |
| Cellular_Localization | Extracellular |
| Gene_Names | NTS |
| UniProt_ID | P30990 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | L2 peptide |
|---|---|
| Peptide_Sequence | HVVEFGLDYPEGM |
| Peptide_Length | 13 |
| Peptide_SMILES | CSCC[C@H](NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1c[nH]cn1)C(C)C)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1492.67 |
|---|---|
| Aliphatic_Index | 74.61538 |
| Aromaticity | 0.15385 |
| Average_Rotatable_Bonds | 3.46154 |
| Charge_at_pH_7 | -2.90796 |
| Isoelectric_Point | 3.92633 |
|---|---|
| Hydrogen_Bond_Acceptors | 20 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 564.54000 |
| X_logP_energy | -2.54280 |
Interaction Information
| Affinity | KD=0.45 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Molecular definition of the interaction between a tumor-specific tetrabranched peptide and LRP6 receptor |
| Release_Year | 2020 |
| PMID | 32556741 |
| DOI | 10.1007/s00726-020-02860-1 |