PPIRE16916
Target Protein Information
| Protein_Name | Casein kinase II subunit beta |
|---|---|
| Protein_Sequence | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR |
| Organism_Source | Homo sapiens |
| Functional_Classification | protein kinases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | CSNK2B |
| UniProt_ID | P67870 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P1 |
|---|---|
| Peptide_Sequence | GKMNGVLPLAWPSLYLRLP |
| Peptide_Length | 19 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)CN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2125.60 |
|---|---|
| Aliphatic_Index | 123.15789 |
| Aromaticity | 0.10526 |
| Average_Rotatable_Bonds | 3.31579 |
| Charge_at_pH_7 | 1.99684 |
| Isoelectric_Point | 10.45492 |
|---|---|
| Hydrogen_Bond_Acceptors | 26 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 748.01000 |
| X_logP_energy | -2.50213 |
Interaction Information
| Affinity | KD=0.4 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | p53-dependent inhibition of mammalian cell survival by a genetically selected peptide aptamer that targets the regulatory subunit of protein kinase CK2 |
| Release_Year | 2006 |
| PMID | 16751801 |
| DOI | 10.1038/sj.onc.1209722 |