PPIRE16929
Target Protein Information
| Protein_Name | HLA class I histocompatibility antigen A alpha chain |
|---|---|
| Protein_Sequence | MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class1 |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-A |
| UniProt_ID | P04439 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | photo-FluM158-66 |
|---|---|
| Peptide_Sequence | GILGFVFXL |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)O)C(C)C |
| Chemical_Modification | X8=3-amino-3-(2-nitro)phenyl-propionic acid |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 922.13 |
|---|---|
| Aliphatic_Index | 162.22222 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 3.11111 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 10 |
| Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 296.12000 |
| X_logP_energy | 0.45060 |
Interaction Information
| Affinity | KD=1.11 uM |
|---|---|
| Affinity_Assay | sedimentation velocitynalytical ultracentrifugation |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Interaction of TAPBPR a tapasin homolog with MHC-I molecules promotes peptide editing |
| Release_Year | 2016 |
| PMID | 26869717 |
| DOI | 10.1073/pnas.1519894113 |