PPIRE17027
Target Protein Information
| Protein_Name | ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 |
|---|---|
| Protein_Sequence | MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL |
| Organism_Source | Homo sapiens |
| Functional_Classification | GPI anchored membrane receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | BST1 |
| UniProt_ID | Q10588 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H01A |
|---|---|
| Peptide_Sequence | ASQISGKYQRYLKDA |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](C)N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1727.94 |
|---|---|
| Aliphatic_Index | 65.33333 |
| Aromaticity | 0.13333 |
| Average_Rotatable_Bonds | 3.93333 |
| Charge_at_pH_7 | 1.99614 |
| Isoelectric_Point | 9.92854 |
|---|---|
| Hydrogen_Bond_Acceptors | 26 |
| Hydrogen_Bond_Donors | 28 |
| Topological_Polar_Surface_Area | 789.06000 |
| X_logP_energy | -8.64293 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Weak interaction between inhibition peptides and a soluble receptor of fusion protein in the liquid phase |
| Release_Year | 2006 |
| PMID | 16966807 |
| DOI | 10.2116/analsci.22.1185 |