PPIRE17129
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | XSARNPTIYPLTLPRALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGGYTMSSQLTLPAVECPEGESVKCSVQHDSNAVQELDVKCSGPPPPCPPCPPSCHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPPSEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDGICY |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | Igha |
| UniProt_ID | A0A075B6A3 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p100c |
|---|---|
| Peptide_Sequence | CYKPLGALTHC |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CS)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C1<-->C11; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1205.46 |
|---|---|
| Aliphatic_Index | 80.00000 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.18182 |
| Charge_at_pH_7 | 0.96380 |
| Isoelectric_Point | 8.23279 |
|---|---|
| Hydrogen_Bond_Acceptors | 18 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 440.69000 |
| X_logP_energy | -3.22050 |
Interaction Information
| Affinity | IC50=1000 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Toward a Better Understanding of the Basis of the Molecular Mimicry of Polysaccharide Antigens by Peptides: THE EXAMPLE OF SHIGELLA FLEXNERI 5A |
| Release_Year | 2006 |
| PMID | 16251186 |
| DOI | 10.1074/jbc.M510172200 |