PPIRE17269
Target Protein Information
| Protein_Name | Serpin B3 |
|---|---|
| Protein_Sequence | MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine protease inhibitors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SERPINB3 |
| UniProt_ID | P29508 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PreS1(21-47) |
|---|---|
| Peptide_Sequence | CPNFDWDPNNSNAGFAPDLQHDPFFGLP |
| Peptide_Length | 28 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3133.36 |
|---|---|
| Aliphatic_Index | 35.00000 |
| Aromaticity | 0.17857 |
| Average_Rotatable_Bonds | 3.10714 |
| Charge_at_pH_7 | -3.97130 |
| Isoelectric_Point | 3.66111 |
|---|---|
| Hydrogen_Bond_Acceptors | 41 |
| Hydrogen_Bond_Donors | 37 |
| Topological_Polar_Surface_Area | 1234.42000 |
| X_logP_energy | -12.33770 |
Interaction Information
| Affinity | KD=16 pM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding and Uptake into Human Hepatocellular Carcinoma Cells of Peptide-Functionalized Gold Nanoparticles |
| Release_Year | 2016 |
| PMID | 27771945 |
| DOI | 10.1021/acs.bioconjchem.6b00441 |