PPIRE17355
Target Protein Information
| Protein_Name | Insulin-like growth factor-binding protein 1 |
|---|---|
| Protein_Sequence | MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
| Organism_Source | Homo sapiens |
| Functional_Classification | IGF binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | IGFBP1 |
| UniProt_ID | P08833 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | bp1-01 |
|---|---|
| Peptide_Sequence | CRAGPLQWLCEKYFG |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chainide chain cyclization; C1<-->C10; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1771.08 |
|---|---|
| Aliphatic_Index | 58.66667 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | 0.87466 |
| Isoelectric_Point | 8.22118 |
|---|---|
| Hydrogen_Bond_Acceptors | 23 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 666.26000 |
| X_logP_energy | -3.63623 |
Interaction Information
| Affinity | KD=1.1 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure-Function Analysis of a Phage Display-Derived Peptide That Binds to Insulin-like Growth Factor Binding Protein 1 |
| Release_Year | 2001 |
| PMID | 11456486 |
| DOI | 10.1021/bi0103866 |