PPIRE17427
Target Protein Information
| Protein_Name | Major prion protein |
|---|---|
| Protein_Sequence | MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG |
| Organism_Source | Mus musculus |
| Functional_Classification | prion proteins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Prnp |
| UniProt_ID | P04925 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | i-PrP13 |
|---|---|
| Peptide_Sequence | DAPAAPAGPAVPV |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@@H](N)CC(=O)O)C(C)C)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1132.28 |
|---|---|
| Aliphatic_Index | 83.07692 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 1.92308 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 414.66000 |
| X_logP_energy | -4.24170 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Effects of u-sheet breaker peptide polymers on scrapie-infected mouse neuroblastoma cells and their affinities to prion protein fragment PrP(8145) |
| Release_Year | 2003 |
| PMID | 12948186 |
| DOI | 10.1039/b306682g |