PPIRE17499
Target Protein Information
| Protein_Name | Centrin-2 |
|---|---|
| Protein_Sequence | MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
| Organism_Source | Homo sapiens |
| Functional_Classification | calcium binding proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | CETN2 |
| UniProt_ID | P41208 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P11-XPC |
|---|---|
| Peptide_Sequence | RALGNWKLLAK |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1269.56 |
|---|---|
| Aliphatic_Index | 124.54545 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.90909 |
| Charge_at_pH_7 | 2.99739 |
| Isoelectric_Point | 11.82306 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 527.14000 |
| X_logP_energy | -2.82353 |
Interaction Information
| Affinity | KD=100 nM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding of Calcium Magnesium and Target Peptides to Cdc31 the Centrin of Yeast Saccharomyces cerevisiae |
| Release_Year | 2011 |
| PMID | 21714500 |
| DOI | 10.1021/bi200518d |