PPIRE17572
Target Protein Information
| Protein_Name | Tax1-binding protein 3 |
|---|---|
| Protein_Sequence | MSYTPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
| Organism_Source | Mus musculus |
| Functional_Classification | PDZ domain containing proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Tax1bp3 |
| UniProt_ID | Q9DBG9 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PDZ-pep WT |
|---|---|
| Peptide_Sequence | CQLAWFDTDL |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CS)[C@@H](C)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | biotin |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1211.35 |
|---|---|
| Aliphatic_Index | 88.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | -2.06310 |
| Isoelectric_Point | 3.49187 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 478.93000 |
| X_logP_energy | -2.63420 |
Interaction Information
| Affinity | KD=0.446 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Dynamic Force Spectroscopy of the Specific Interaction between the PDZ Domain and Its Recognition Peptides |
| Release_Year | 2007 |
| PMID | 17269804 |
| DOI | 10.1021/la0627011 |