PPIRE17608
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 2A |
|---|---|
| Protein_Sequence | KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGLDLDDVCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFKVKWIFSSVVELKQTISPDYRNMIGQGA |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg2a |
| UniProt_ID | P01865 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Decapeptide 10312 |
|---|---|
| Peptide_Sequence | TTAETLAATR |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1034.13 |
|---|---|
| Aliphatic_Index | 69.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.20000 |
| Charge_at_pH_7 | -0.00024 |
| Isoelectric_Point | 6.41015 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 505.34000 |
| X_logP_energy | -7.48143 |
Interaction Information
| Affinity | KD=0.13 uM |
|---|---|
| Affinity_Assay | equilibrium dialysis |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The antibody response to a single antigenic determinant of the tobacco mosaic virus protein: analysis using monoclonal antibodies mutant proteins and synthetic peptides |
| Release_Year | 1984 |
| PMID | 6203033 |
| DOI | 10.1016/0161-5890(84)90101-9 |