PPIRE17678
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 1 |
|---|---|
| Protein_Sequence | ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA |
| Organism_Source | Homo sapiens |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | IGHG1 |
| UniProt_ID | P01857 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | min19Fc |
|---|---|
| Peptide_Sequence | GSYWYQVWF |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)CN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1235.36 |
|---|---|
| Aliphatic_Index | 32.22222 |
| Aromaticity | 0.55556 |
| Average_Rotatable_Bonds | 3.55556 |
| Charge_at_pH_7 | -0.00372 |
| Isoelectric_Point | 6.08660 |
|---|---|
| Hydrogen_Bond_Acceptors | 14 |
| Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 431.48000 |
| X_logP_energy | 0.40920 |
Interaction Information
| Affinity | KD=652 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development and characterization of peptide ligands of immunoglobulin G Fc region |
| Release_Year | 2018 |
| PMID | 30024737 |
| DOI | 10.1021/acs.bioconjchem.8b00395 |