PPIRE17705
Target Protein Information
| Protein_Name | Galectin-4 |
|---|---|
| Protein_Sequence | MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI |
| Organism_Source | Homo sapiens |
| Functional_Classification | lectins |
| Cellular_Localization | Extracellular |
| Gene_Names | LGALS4 |
| UniProt_ID | P56470 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | t-PA-peptide-1Lac-C-Fluorescein |
|---|---|
| Peptide_Sequence | GTWSTAESGAECTNWXSSALAQKPYSGRK |
| Peptide_Length | 29 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | X16=Ser(u-d-lactose); K29=Fluorescein |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3031.26 |
|---|---|
| Aliphatic_Index | 27.24138 |
| Aromaticity | 0.10345 |
| Average_Rotatable_Bonds | 3.31034 |
| Charge_at_pH_7 | 0.93812 |
| Isoelectric_Point | 8.51864 |
|---|---|
| Hydrogen_Bond_Acceptors | 47 |
| Hydrogen_Bond_Donors | 50 |
| Topological_Polar_Surface_Area | 1357.70000 |
| X_logP_energy | -20.04803 |
Interaction Information
| Affinity | KD=12.7 uM |
|---|---|
| Affinity_Assay | Microscale Thermophoresis |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and functionalization of protease-activated nanoparticles with tissue plasminogen activator peptides as targeting moiety and diagnostic tool for pancreatic cancer |
| Release_Year | 2016 |
| PMID | 27993133 |
| DOI | 10.1186/s12951-016-0236-3 |