PPIRE17707
Target Protein Information
| Protein_Name | T cell receptor alpha chain constant/T-cell receptor beta-2 chain C region |
|---|---|
| Protein_Sequence | IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS/EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLVLMAMVKKKNS |
| Organism_Source | Homo sapiens/Mus musculus |
| Functional_Classification | T cell receptors |
| Cellular_Localization | Plasma membrane |
| Gene_Names | TRAC/ |
| UniProt_ID | P01848/P01851 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Tax |
|---|---|
| Peptide_Sequence | LLFGYPVYV |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)O)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1070.30 |
|---|---|
| Aliphatic_Index | 151.11111 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 3.11111 |
| Charge_at_pH_7 | -0.00372 |
| Isoelectric_Point | 6.08660 |
|---|---|
| Hydrogen_Bond_Acceptors | 12 |
| Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 327.79000 |
| X_logP_energy | 1.95780 |
Interaction Information
| Affinity | KD=1.35 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | T Cell Receptor Binding Transition States and Recognition of Peptide/MHC |
| Release_Year | 2007 |
| PMID | 17249694 |
| DOI | 10.1021/bi061702p |