PPIRE17840
Target Protein Information
| Protein_Name | Phospholipase A2 membrane associated |
|---|---|
| Protein_Sequence | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC |
| Organism_Source | Homo sapiens |
| Functional_Classification | phospholipase A2 |
| Cellular_Localization | Extracellular |
| Gene_Names | PLA2G2A |
| UniProt_ID | P14555 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FLTYK |
|---|---|
| Peptide_Sequence | FLTYK |
| Peptide_Length | 5 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 670.81 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.40000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 0.99684 |
| Isoelectric_Point | 9.29830 |
|---|---|
| Hydrogen_Bond_Acceptors | 9 |
| Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 246.20000 |
| X_logP_energy | 0.08440 |
Interaction Information
| Affinity | IC50=2300 uM |
|---|---|
| Affinity_Assay | E. coli membrane assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A Novel Approach to the Design of Inhibitors of Human Secreted Phospholipase A2 Based on Native Peptide Inhibition |
| Release_Year | 2001 |
| PMID | 11427527 |
| DOI | 10.1074/jbc.M101272200 |