PPIRE17871
Target Protein Information
| Protein_Name | Plasmid partition protein A |
|---|---|
| Protein_Sequence | MSDSSQLHKVAQRANRMLNVLTEQVQLQKDELHANEFYQVYAKAALAKLPLLTRANVDYAVSEMEEKGYVFDKRPAGSSMKYAMSIQNIIDIYEHRGVPKYRDRYSEAYVIFISNLKGGVSKTVSTVSLAHAMRAHPHLLMEDLRILVIDLDPQSSATMFLSHKHSIGIVNATSAQAMLQNVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHLPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLISDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATYVGSADALKNARIAAEDFAKAVFDRIEFIRSN |
| Organism_Source | Escherichia coli |
| Functional_Classification | peptidyl prolyl cis trans isomerase |
| Cellular_Localization | Cytoplasm |
| Gene_Names | parA |
| UniProt_ID | P07620 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 7 |
|---|---|
| Peptide_Sequence | GLADRATFVVDPQGIIQA |
| Peptide_Length | 18 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)CN)[C@@H](C)O)C(C)C)C(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1871.12 |
|---|---|
| Aliphatic_Index | 113.88889 |
| Aromaticity | 0.05556 |
| Average_Rotatable_Bonds | 3.27778 |
| Charge_at_pH_7 | -1.00113 |
| Isoelectric_Point | 4.10925 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 792.14000 |
| X_logP_energy | -7.71393 |
Interaction Information
| Affinity | IC50=62.1 uM |
|---|---|
| Affinity_Assay | protease-free PPIase assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The Protein-Free IANUS Peptide Array Uncovers Interaction Sites between Escherichia coli Parvulin 10 and Alkyl Hydroperoxide Reductase |
| Release_Year | 2010 |
| PMID | 20806779 |
| DOI | 10.1021/bi101015p |