PPIRE17922
Target Protein Information
| Protein_Name | Melanocortin receptor 5 |
|---|---|
| Protein_Sequence | MNSSSTLTVLNLTLNASEDGILGSNVKNKSLACEEMGIAVEVFLTLGLVSLLENILVIGAIVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETVTIYLLNNKHLVIADTFVRHIDNVFDSMICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIYYESKYVIICLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRTSMKGAITLTMLLGIFIVCWSPFFLHLILMISCPQNVYCSCFMSYFNMYLILIMCNSVIDPLIYALRSQEMRRTFKEIVCCHGFRRPCRLLGGY |
| Organism_Source | Mus musculus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Mc5r |
| UniProt_ID | P41149 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Compound_3 |
|---|---|
| Peptide_Sequence | YCXfRWNAPCY |
| Peptide_Length | 11 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | X3=MIM(His) |
| Cyclization_Method | Side chain-side chain cyclization; C2<-->C10; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1379.57 |
|---|---|
| Aliphatic_Index | 9.09091 |
| Aromaticity | 0.36364 |
| Average_Rotatable_Bonds | 3.27273 |
| Charge_at_pH_7 | 0.87233 |
| Isoelectric_Point | 8.21452 |
|---|---|
| Hydrogen_Bond_Acceptors | 18 |
| Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 506.77000 |
| X_logP_energy | -2.73463 |
Interaction Information
| Affinity | EC50=305 nM |
|---|---|
| Affinity_Assay | cAMP-based Beta-galactosidase reporter gene assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Incorporation of a Bioactive Reverse-Turn Heterocycle into a Peptide Template Using Solid-Phase Synthesis To Probe Melanocortin Receptor Selectivity and Ligand Conformations by 2D 1H NMR |
| Release_Year | 2011 |
| PMID | 21306168 |
| DOI | 10.1021/jm101425m |