PPIRE18001
Target Protein Information
| Protein_Name | Large envelope protein |
|---|---|
| Protein_Sequence | MGHTQAKSTTDRRVEGGELLLQHLAGRMIPPEFSGPITTAGKFPTIQHVMDHIDSVEELRTLQAGGHWPEGTARRLGLDQPRPTPPPITWTEEEDKKAKEFFKQYQENRPKPAETAPPPITELHAAEPPQWKISPEDPLLKAKALIPVKEPEVPILKVPKLTNKKKMGATFGGILAGLIGLLVGFFLLTKILEILRKLDWWWISLSSPKEKMLCAFQNTGAQTSPHYVGSCPWGCPGFLWTYLRLFIIFLLLLLVAAGLLFLTENKSTIFEKLQWESVSALSSSIYSLLPSEPKSLVALTFGLFLIWTTSSSVTQVLVTLTQLATLSALFFKNSG |
| Organism_Source | Heron hepatitis B virus |
| Functional_Classification | viral envelope proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | S |
| UniProt_ID | P13847 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ETGAKPH |
|---|---|
| Peptide_Sequence | CETGAKPHC |
| Peptide_Length | 9 |
| Peptide_SMILES | C[C@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CS)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C1<-->C9; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 945.08 |
|---|---|
| Aliphatic_Index | 11.11111 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.11111 |
| Charge_at_pH_7 | -0.03358 |
| Isoelectric_Point | 7.25383 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 399.56000 |
| X_logP_energy | -5.36580 |
Interaction Information
| Affinity | KD=2.9 nM |
|---|---|
| Affinity_Assay | equilibrium binding assay in solution |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A phage-displayed cyclic peptide that interacts tightly with the immunodominant region of hepatitis B surface antigen |
| Release_Year | 2005 |
| PMID | 16087122 |
| DOI | 10.1016/j.jcv.2005.01.007 |