PPIRE18037
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MSFLFSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTESTCSVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDAVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR |
| Organism_Source | Xenopus laevis |
| Functional_Classification | protein kinase regulatory subunits |
| Cellular_Localization | Cytoplasm |
| Gene_Names | mob1a.L |
| UniProt_ID | Q7T1M9 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | XlNDR68-86 |
|---|---|
| Peptide_Sequence | AHARKETEFLRLKRTRLGLW |
| Peptide_Length | 20 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)N)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2481.93 |
|---|---|
| Aliphatic_Index | 88.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 4.25000 |
| Charge_at_pH_7 | 4.09184 |
| Isoelectric_Point | 12.07913 |
|---|---|
| Hydrogen_Bond_Acceptors | 32 |
| Hydrogen_Bond_Donors | 41 |
| Topological_Polar_Surface_Area | 1075.39000 |
| X_logP_energy | -7.80012 |
Interaction Information
| Affinity | KD=100 nM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | 1R3B |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | NMR Solution Structure of Mob1 a Mitotic Exit Network Protein and its Interaction with an NDR Kinase Peptide |
| Release_Year | 2004 |
| PMID | 15001360 |
| DOI | 10.1016/j.jmb.2004.01.010 |