PPIRE18042
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form/Immunoglobulin kappa constant |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK/RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC |
| Organism_Source | Mus musculus/Mus musculus |
| Functional_Classification | monoclonal antibody |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1/Igkc |
| UniProt_ID | P01868/P01837 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | YDGRSGYYIGGKR |
|---|---|
| Peptide_Sequence | YDGRSGYYIGGKR |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1491.63 |
|---|---|
| Aliphatic_Index | 30.00000 |
| Aromaticity | 0.23077 |
| Average_Rotatable_Bonds | 3.69231 |
| Charge_at_pH_7 | 1.99558 |
| Isoelectric_Point | 9.77995 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 680.56000 |
| X_logP_energy | -7.24496 |
Interaction Information
| Affinity | IC50=4 mM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Epitope mapping of a C5a neutralizing mAb using a combined approach of phage display synthetic peptides and site-directed mutagenesis |
| Release_Year | 1996 |
| PMID | None |
| DOI | 10.1016/S1380-2933(96)0042-5 |