PPIRE18044
Target Protein Information
| Protein_Name | IgG receptor FcRn large subunit p51 |
|---|---|
| Protein_Sequence | MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class1 like |
| Cellular_Localization | Plasma membrane |
| Gene_Names | FCGRT |
| UniProt_ID | P55899 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 2 |
|---|---|
| Peptide_Sequence | RFXTGHFGXSXPCRFXTGHFGXSXPC |
| Peptide_Length | 26 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CNC(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)O)C(=O)NCC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | X3=Pen; X9=Sar; X10=N-methylleucine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | succinyl (homodimer linker) |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2540.78 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.15385 |
| Average_Rotatable_Bonds | 2.88462 |
| Charge_at_pH_7 | 2.05585 |
| Isoelectric_Point | 8.84086 |
|---|---|
| Hydrogen_Bond_Acceptors | 37 |
| Hydrogen_Bond_Donors | 39 |
| Topological_Polar_Surface_Area | 1035.32000 |
| X_logP_energy | -16.12056 |
Interaction Information
| Affinity | IC50=4.6 nM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | PEGylation enhances the therapeutic potential of peptide antagonists of the neonatal Fc receptor FcRn |
| Release_Year | 2011 |
| PMID | 21920737 |
| DOI | 10.1016/j.bmcl.2011.08.111 |