PPIRE18051
Target Protein Information
| Protein_Name | C-C motif chemokine 5 |
|---|---|
| Protein_Sequence | MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Organism_Source | Homo sapiens |
| Functional_Classification | CC chemokines |
| Cellular_Localization | Extracellular |
| Gene_Names | CCL5 |
| UniProt_ID | P13501 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Nt-CCR5(1-27) |
|---|---|
| Peptide_Sequence | MDYQVSSPIXDINXYTSEPAQKINVKQ |
| Peptide_Length | 27 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)O)C(C)C)[C@@H](C)CC)[C@@H](C)O |
| Chemical_Modification | X10=sulfotyrosine; X14=sulfotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2983.30 |
|---|---|
| Aliphatic_Index | 68.51852 |
| Aromaticity | 0.07407 |
| Average_Rotatable_Bonds | 3.62963 |
| Charge_at_pH_7 | -1.00164 |
| Isoelectric_Point | 4.37040 |
|---|---|
| Hydrogen_Bond_Acceptors | 45 |
| Hydrogen_Bond_Donors | 42 |
| Topological_Polar_Surface_Area | 1303.11000 |
| X_logP_energy | -15.62460 |
Interaction Information
| Affinity | KD=52 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Detection of intermolecular transferred-NOE interactions in small and medium size protein complexes: RANTES complexed with a CCR5 N-terminal peptide |
| Release_Year | 2017 |
| PMID | 28052516 |
| DOI | 10.1111/febs.14000 |