PPIRE18056
Target Protein Information
| Protein_Name | Cell division control protein 42 homolog |
|---|---|
| Protein_Sequence | MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL |
| Organism_Source | Homo sapiens |
| Functional_Classification | small GTPases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | CDC42 |
| UniProt_ID | P60953 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PAK2(71-92) |
|---|---|
| Peptide_Sequence | RPEISPPSDFEHTIHVGFDAVT |
| Peptide_Length | 22 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@H](C(=O)O)[C@@H](C)O)C(C)C)C(C)C)[C@@H](C)CC)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2451.68 |
|---|---|
| Aliphatic_Index | 66.36364 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.27273 |
| Charge_at_pH_7 | -2.81576 |
| Isoelectric_Point | 4.53289 |
|---|---|
| Hydrogen_Bond_Acceptors | 34 |
| Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 997.43000 |
| X_logP_energy | -9.74133 |
Interaction Information
| Affinity | KD=0.6 uM |
|---|---|
| Affinity_Assay | fluorescence titration |
| PDB_ID | None |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Conformation of a Cdc42/Rac Interactive Binding Peptide in Complex with Cdc42 and Analysis of the Binding Interface |
| Release_Year | 1999 |
| PMID | 10320322 |
| DOI | 10.1021/bi990426u |