PPIRE18137
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MGLFLPLEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
| Organism_Source | Gallus gallus |
| Functional_Classification | EF hand calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | CALM1 |
| UniProt_ID | A0A8V0YVM4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | smMLCKp |
|---|---|
| Peptide_Sequence | GSARRKWQKTGHAVRAIGRLS |
| Peptide_Length | 21 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)CN)[C@@H](C)O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2335.70 |
|---|---|
| Aliphatic_Index | 65.23810 |
| Aromaticity | 0.04762 |
| Average_Rotatable_Bonds | 3.80952 |
| Charge_at_pH_7 | 6.08829 |
| Isoelectric_Point | 12.98470 |
|---|---|
| Hydrogen_Bond_Acceptors | 33 |
| Hydrogen_Bond_Donors | 42 |
| Topological_Polar_Surface_Area | 1093.21000 |
| X_logP_energy | -13.57182 |
Interaction Information
| Affinity | KD=1 nM |
|---|---|
| Affinity_Assay | binding assay |
| PDB_ID | 1CDL |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Redistribution and loss of side chain entropy upon formation of a calmodulin-peptide complex |
| Release_Year | 2000 |
| PMID | 10625431 |
| DOI | 10.1038/71280 |