PPIRE18143
Target Protein Information
| Protein_Name | Troponin C slow skeletal and cardiac muscles |
|---|---|
| Protein_Sequence | LLSVFHLQVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDGRSLSCLKFGCESLSSSHGLSCLLGAGVSLCRQSWATRLIPSWVCMELGRFSGL |
| Organism_Source | Meleagris gallopavo |
| Functional_Classification | calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TNNC1 |
| UniProt_ID | H9H068 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Nor-acetyl[19F-Phe106]-TnI(104-115)-amide |
|---|---|
| Peptide_Sequence | XXXXXXXXXXXX |
| Peptide_Length | 12 |
| Peptide_SMILES | NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | X3=4-fluorophenylalanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 702.64 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 1.91667 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 383.42000 |
| X_logP_energy | -10.69210 |
Interaction Information
| Affinity | KD=0.056 mM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Interaction of troponin I and troponin C: 19F NMR studies of the binding of the inhibitory troponin I peptide to turkey skeletal troponin C |
| Release_Year | 1991 |
| PMID | 1793571 |
| DOI | 10.1139/o91-101 |