PPIRE18180
Target Protein Information
| Protein_Name | Bacterial microcompartment shell protein PduK |
|---|---|
| Protein_Sequence | MKQSLGLLEVSGLALAISCADVMAKAASITLVGLEKTNGSGWMVIKIIGDVASVQAAISTGVSFADQRDGLVAHKVISRPGDGILSHSVTPESESEPAPAPTPVVPHEEIPEDHAAPEAPQDAELISCNLCLDPACPRQKGEPRSLCLHSGKRGEA |
| Organism_Source | Citrobacter freundii |
| Functional_Classification | BMC shell proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | pduK |
| UniProt_ID | B1VB70 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P18 |
|---|---|
| Peptide_Sequence | MNTSELETLIRNLISEQL |
| Peptide_Length | 18 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CCSC)[C@@H](C)O)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2104.40 |
|---|---|
| Aliphatic_Index | 130.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.11111 |
| Charge_at_pH_7 | -1.99669 |
| Isoelectric_Point | 3.98005 |
|---|---|
| Hydrogen_Bond_Acceptors | 31 |
| Hydrogen_Bond_Donors | 32 |
| Topological_Polar_Surface_Area | 942.01000 |
| X_logP_energy | -9.71023 |
Interaction Information
| Affinity | KD=331 nM |
|---|---|
| Affinity_Assay | intrinsic tryptophan fluorescence |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Solution Structure of a Bacterial Microcompartment Targeting Peptide and Its Application in the Construction of an Ethanol Bioreactor |
| Release_Year | 2014 |
| PMID | 24933391 |
| DOI | 10.1021/sb4001118 |