PPIRE18271
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | antibodies |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1 |
| UniProt_ID | P01868 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P514 |
|---|---|
| Peptide_Sequence | ADWADWLDYPG |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1308.37 |
|---|---|
| Aliphatic_Index | 53.63636 |
| Aromaticity | 0.27273 |
| Average_Rotatable_Bonds | 3.09091 |
| Charge_at_pH_7 | -3.00153 |
| Isoelectric_Point | 3.33853 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 509.24000 |
| X_logP_energy | -1.70980 |
Interaction Information
| Affinity | KD=7.8 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide libraries define the fine specificity of anti-polysaccharide antibodies to Cryptococcus neoformans |
| Release_Year | 1996 |
| PMID | 8760499 |
| DOI | 10.1006/jmbi.1996.0438 |