PPIRE18283
Target Protein Information
| Protein_Name | Interleukin-17A |
|---|---|
| Protein_Sequence | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Organism_Source | Homo sapiens |
| Functional_Classification | interleukins |
| Cellular_Localization | Extracellular |
| Gene_Names | IL17A |
| UniProt_ID | Q16552 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PyroE-CVX5484 |
|---|---|
| Peptide_Sequence | PyrEIHVTIPADLWDWINK |
| Peptide_Length | 19 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1)[C@@H](C)CC)C(C)C)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | pyroglutamate |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2366.70 |
|---|---|
| Aliphatic_Index | 102.63158 |
| Aromaticity | 0.15789 |
| Average_Rotatable_Bonds | 3.73684 |
| Charge_at_pH_7 | -0.90959 |
| Isoelectric_Point | 5.51930 |
|---|---|
| Hydrogen_Bond_Acceptors | 29 |
| Hydrogen_Bond_Donors | 32 |
| Topological_Polar_Surface_Area | 907.97000 |
| X_logP_energy | -3.25933 |
Interaction Information
| Affinity | KD=6 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Pyroglutamate and O-Linked Glycan Determine Functional Production of Anti-IL17A and Anti-IL22 Peptide-Antibody Bispecific Genetic Fusions |
| Release_Year | 2013 |
| PMID | 23184956 |
| DOI | 10.1074/jbc.M112.417717 |