PPIRE18297
Target Protein Information
| Protein_Name | Peptidyl-prolyl cis-trans isomerase A |
|---|---|
| Protein_Sequence | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
| Organism_Source | Homo sapiens |
| Functional_Classification | peptidyl prolyl isomerases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PPIA |
| UniProt_ID | P62937 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AIF(370-394)K388Q |
|---|---|
| Peptide_Sequence | QSVGVSSGKLLIKLKDGRQVETDHI |
| Peptide_Length | 25 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCC(N)=O)C(C)C)C(C)C)[C@@H](C)CC)C(C)C)[C@@H](C)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2708.11 |
|---|---|
| Aliphatic_Index | 112.80000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.88000 |
| Charge_at_pH_7 | 1.09067 |
| Isoelectric_Point | 9.44205 |
|---|---|
| Hydrogen_Bond_Acceptors | 40 |
| Hydrogen_Bond_Donors | 42 |
| Topological_Polar_Surface_Area | 1209.36000 |
| X_logP_energy | -13.55483 |
Interaction Information
| Affinity | KD=30.2 uM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding mode of AIF(370-394) peptide to CypA: insights from NMR label-free and molecular docking studies |
| Release_Year | 2018 |
| PMID | 29891613 |
| DOI | 10.1042/BCJ20180177 |