PPIRE18314
Target Protein Information
| Protein_Name | Regulator of G-protein signaling 4 |
|---|---|
| Protein_Sequence | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKVVTCQRVSQEEVKKWAESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNPSSCGAEKQKGAKSSADCTSLVPQCA |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | GTPase activating proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Rgs4 |
| UniProt_ID | P49799 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 2 |
|---|---|
| Peptide_Sequence | VKCTGICE |
| Peptide_Length | 8 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C3<-->C7; other bonds |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 852.03 |
|---|---|
| Aliphatic_Index | 85.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -0.12449 |
| Isoelectric_Point | 6.13535 |
|---|---|
| Hydrogen_Bond_Acceptors | 14 |
| Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 350.57000 |
| X_logP_energy | -3.64040 |
Interaction Information
| Affinity | IC50=300 uM |
|---|---|
| Affinity_Assay | single turnover GTPase |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Mechanism of Action and Structural Requirements of Constrained Peptide Inhibitors of RGS Proteins |
| Release_Year | 2006 |
| PMID | 16629824 |
| DOI | 10.1111/j.1747-0285.2006.00373.x |