PPIRE18404
Target Protein Information
| Protein_Name | Microtubule-associated protein tau |
|---|---|
| Protein_Sequence | MAEPRQEFDVMEDHAQGDYTLQDQEGDMDPGLKESPLQTPADDGSEEPGSETSDAKSTPTAEDATAPLVDEGAPGEQAAAQAPAEIPEGTAAEEAGIGDTSNLEDQAAGHVTQARMVSKGKDGTGPDDKKTKGADGKPGTKIATPRGAAPPGQKGQANATRIPAKTTPTPKTSPATMQVQKKPPPAGAKSERGESGKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSAAKSRLQAAPGPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL |
| Organism_Source | Bos taurus |
| Functional_Classification | microtubule associated proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAPT |
| UniProt_ID | P29172 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PT1 |
|---|---|
| Peptide_Sequence | GGDRSGYSSPGSPGTPG |
| Peptide_Length | 17 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)CN)C(=O)N1CCC[C@H]1C(=O)NCC(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1535.55 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.05882 |
| Average_Rotatable_Bonds | 2.52941 |
| Charge_at_pH_7 | -0.00242 |
| Isoelectric_Point | 6.33190 |
|---|---|
| Hydrogen_Bond_Acceptors | 26 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 723.13000 |
| X_logP_energy | -14.50163 |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Application of Synthetic Phospho- and Unphospho- Peptides to Identify Phosphorylation Sites in a Subregion of the tau Molecule Which Is Modified in Alzheimer's Disease |
| Release_Year | 1993 |
| PMID | 8455212 |
| DOI | 10.1002/jnr.490340315 |