PPIRE18520
Target Protein Information
| Protein_Name | Chymotrypsin-like elastase family member 2A |
|---|---|
| Protein_Sequence | MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGGTLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGNDIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLVVDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSSLGCNYYHKPSVFTRVSNYIDWINSVIANN |
| Organism_Source | Sus scrofa |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | CELA2A |
| UniProt_ID | P08419 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CF3CO-Ala2-NH-Ph-pNO2 |
|---|---|
| Peptide_Sequence | AA |
| Peptide_Length | 2 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | trifluoroacetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 160.17 |
|---|---|
| Aliphatic_Index | 100.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 1.50000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 3 |
| Hydrogen_Bond_Donors | 3 |
| Topological_Polar_Surface_Area | 92.42000 |
| X_logP_energy | -1.07710 |
Interaction Information
| Affinity | Ki=1.25 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The indirect mechanism of action of the trifluoroacetyl peptides on elastase. Enzymatic and 19F NMR studies |
| Release_Year | 1980 |
| PMID | 6901663 |
| DOI | 10.1111/j.1432-1033.1980.tb06046.x |