PPIRE18597
Target Protein Information
| Protein_Name | Merozoite surface protein 2 |
|---|---|
| Protein_Sequence | MKVIKTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIRRSMAESNPSTGAGGSGSAGGSGSAGGSGSAGGSGSAGGSGSAGSGDGNGANPGADAERSPSTPATTTTTTTTNDAEASTSTSSENPNHNNAETNPKGKGEVQKPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPIAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAAPSLLSNSSNIASINKFVVLISATLVLSFAIFI |
| Organism_Source | Plasmodium falciparum (isolate 7G8) |
| Functional_Classification | surface proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | MSP2 |
| UniProt_ID | Q99320 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 1 |
|---|---|
| Peptide_Sequence | KNESKYSNTFINNAYNMSIR |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2394.64 |
|---|---|
| Aliphatic_Index | 44.00000 |
| Aromaticity | 0.15000 |
| Average_Rotatable_Bonds | 4.05000 |
| Charge_at_pH_7 | 1.99747 |
| Isoelectric_Point | 9.92855 |
|---|---|
| Hydrogen_Bond_Acceptors | 37 |
| Hydrogen_Bond_Donors | 38 |
| Topological_Polar_Surface_Area | 1104.29000 |
| X_logP_energy | -14.26523 |
Interaction Information
| Affinity | KD=72 nM |
|---|---|
| Affinity_Assay | binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Distorting Malaria Peptide Backbone Structure to Enable Fitting into MHC Class II Molecules Renders Modified Peptides Immunogenic and Protective |
| Release_Year | 2003 |
| PMID | 12747797 |
| DOI | 10.1021/jm020440w |