PPIRE18609
Target Protein Information
| Protein_Name | Ubiquitin-conjugating enzyme E2 E2 |
|---|---|
| Protein_Sequence | MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT |
| Organism_Source | Homo sapiens |
| Functional_Classification | Transferases ubiquitin conjugating enzymes |
| Cellular_Localization | Nucleus |
| Gene_Names | UBE2E2 |
| UniProt_ID | Q96LR5 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide4 |
|---|---|
| Peptide_Sequence | TWFWPYPYPHLP |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1603.84 |
|---|---|
| Aliphatic_Index | 32.50000 |
| Aromaticity | 0.41667 |
| Average_Rotatable_Bonds | 2.83333 |
| Charge_at_pH_7 | 0.08719 |
| Isoelectric_Point | 7.53466 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 469.21000 |
| X_logP_energy | 2.73590 |
Interaction Information
| Affinity | IC50=0.4293 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design of peptides as inhibitors of human papillomavirus 16 transcriptional regulator E1-鍌欒兌閸嬨劑宕曢幓2 |
| Release_Year | 2016 |
| PMID | 27203784 |
| DOI | 10.1111/cbdd.12790 |