PPIRE18699
Target Protein Information
| Protein_Name | Tumor necrosis factor ligand superfamily member 6 |
|---|---|
| Protein_Sequence | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Organism_Source | Homo sapiens |
| Functional_Classification | tumor necrosis factor ligands |
| Cellular_Localization | Extracellular |
| Gene_Names | FASLG |
| UniProt_ID | P48023 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 1 |
|---|---|
| Peptide_Sequence | LDTPVPRPPW |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O)C(C)C)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | homoserine lactone |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1177.37 |
|---|---|
| Aliphatic_Index | 68.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 2.70000 |
| Charge_at_pH_7 | -0.00157 |
| Isoelectric_Point | 6.33872 |
|---|---|
| Hydrogen_Bond_Acceptors | 14 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 425.28000 |
| X_logP_energy | -1.66883 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Rapid preparation of stable isotope labeled peptides that bind to target proteins by a phage library system |
| Release_Year | 2006 |
| PMID | 16505961 |
| DOI | 10.1007/s10858-005-5054-0 |