PPIRE18714
Target Protein Information
| Protein_Name | Ig gamma-2A chain C region A allele |
|---|---|
| Protein_Sequence | AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulin G |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg |
| UniProt_ID | P01863 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CSSMGQWAKC |
|---|---|
| Peptide_Sequence | CSSMGQWAKC |
| Peptide_Length | 10 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CS)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | side chain-side chain cyclization; C1<-->C10; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1100.29 |
|---|---|
| Aliphatic_Index | 10.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 0.87374 |
| Isoelectric_Point | 8.22969 |
|---|---|
| Hydrogen_Bond_Acceptors | 18 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 450.58000 |
| X_logP_energy | -5.87140 |
Interaction Information
| Affinity | IC50=120 nM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Analyte Peptidomimetics Selected from Phage Display Peptide Libraries: A Systematic Strategy for the Development of Environmental Immunoassays |
| Release_Year | 2005 |
| PMID | 15984805 |
| DOI | 10.1021/es047931l |