PPIRE18723
Target Protein Information
| Protein_Name | Ig gamma-2A chain C region |
|---|---|
| Protein_Sequence | AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWSSQAVTCNVAHPASSTKVDKKIVPRECNPCGCTGSEVSSVFIFPPKTKDVLTITLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVHRDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEMTQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | IgG |
| Cellular_Localization | Extracellular |
| Gene_Names | Igg-2a |
| UniProt_ID | P20760 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | eTev tag |
|---|---|
| Peptide_Sequence | RENLYFQGKDG |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1326.43 |
|---|---|
| Aliphatic_Index | 35.45455 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 4.09091 |
| Charge_at_pH_7 | -0.00094 |
| Isoelectric_Point | 6.48752 |
|---|---|
| Hydrogen_Bond_Acceptors | 19 |
| Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 623.25000 |
| X_logP_energy | -6.38113 |
Interaction Information
| Affinity | KD=71.4 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | 5AUM |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | An anti-peptide monoclonal antibody recognizing the tobacco etch virus protease-cleavage sequence and its application to a tandem tagging system |
| Release_Year | 2018 |
| PMID | 29550370 |
| DOI | 10.1016/j.pep.2018.03.004 |